Overview

  • Product name
    Recombinant Human Kazrin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRAADSGSWERVRQLAAQGEPAPSCGAGAGPARPPGPAACEQCVDAAGPG DRPRAGVPRVRADGDCSQPVLLREEVSRLQEEVHLLRQMKEMLAKDLEES QGGKSSEVLSATELRVQLAQKEQELARAKEALQAMKADRKRLKGEKTDLV SQMQQLYATLESREEQLRDFIRNYEQHRKESEDAVKALAKEKDLLEREKW ELRRQAKEATDHATALRSQLDLKDNRMKELEAELAMAKQSLATLTKDVPK RHSLAMPGETVLNGNQEWVVQADLPLTAAIRQSQQTLYHSHPPHPADRQA VRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCNGDSPGPV QKNLHNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLF DGTAPDYYIEEDADW
    • Amino acids
      1 to 415
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HRIHFB2003
    • KAZ
    • Kazn
    • Kazrin
    • KAZRN_HUMAN
    • KIAA1026
    • RP1-21O18.1
    see all
  • Function
    Component of the cornified envelope of keratinocytes. May be involved in the interplay between adherens junctions and desmosomes. The function in the nucleus is not known.
  • Tissue specificity
    Isoform 2, isoform 3 and isoform 4 are expressed in several cell lines including keratinocytes and bladder and epidermoid carcinoma (at protein level). Isoform 2, isoform 3 and isoform 4 are expressed in hair follicle and interfollicular epidermis (at protein level).
  • Sequence similarities
    Belongs to the kazrin family.
    Contains 3 SAM (sterile alpha motif) domains.
  • Cellular localization
    Cytoplasm > cytoskeleton and Cytoplasm. Cell junction > desmosome. Nucleus. Observed at the apical plasma mebrane of keratinocytes. Partially colocalizes with PPL and DP at desmosomes, and with PP at the interdesmosomal plasma membrane. Colocalizes with cortical actin-based membrane structures.
  • Information by UniProt

Images

  • ab161582 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up