Overview

  • Product name
    Recombinant Human KBTBD10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKV LKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKD
    • Amino acids
      205 to 304
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cb52
    • fb24f05
    • fc15e07
    • Gm112
    • KBTBA_HUMAN
    • Kbtbd10
    • Kel like protein 23
    • Kel-like protein 23
    • Kelch related protein 1
    • Kelch repeat and BTB domain-containing protein 10
    • Kelch-related protein 1
    • KRP1
    • MGC143407
    • Sarcosin
    • sbcb52
    • wufb24f05
    • wufc15e07
    see all
  • Function
    Required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity
    Sarcomeric muscle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 5 Kelch repeats.
  • Post-translational
    modifications
    Ubiquitinated and probably targeted for proteasome-independent degradation.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Cell projection > pseudopodium. Cell projection > ruffle. Predominantly cytoplasmic but can co-localize with F-actin at the membrane ruffle-like structures at the tips of transformation-specific pseudopodia.
  • Information by UniProt

Images

  • ab160945 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up