Description

  • Product name

    Recombinant Human KBTBD7 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQSREDVPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALL AQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMF TGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDM LQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSYIAHNF KQLSRMGSIREETLADLTLAQLLAVLRLDSLDIESERTVCHVAVQWLEAA AKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQ MRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFG HPRDPFLCYDPYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQ PRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRDPITGVK LKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPS HNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNI PLDSETHNYQIVNHDQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGT MLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFS ELDSESGSSSSFSDDEVWVQVAPQRNAQDQQGSL
    • Predicted molecular weight

      104 kDa including tags
    • Amino acids

      1 to 684

Specifications

Our Abpromise guarantee covers the use of ab132792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1110008P08Rik
    • AU045792
    • DKFZP434E2318
    • Gm295
    • KBTB7_HUMAN
    • KBTBD 7
    • KBTBD7
    • Kelch repeat and BTB (POZ) domain containing 7
    • Kelch repeat and BTB domain containing protein 7
    • Kelch repeat and BTB domain-containing protein 7
    • OTTHUMP00000018313
    see all
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 5 Kelch repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132792 stained with Coomassie Blue.

References

ab132792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up