Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQA LPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQT KFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFN AFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEE MLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFI ESCQKDENIMRSMQLFDNVI
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 270

Specifications

Our Abpromise guarantee covers the use of ab131900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A type potassium channel modulatory protein 2
    • A-type potassium channel modulatory protein 2
    • Cardiac voltage gated potassium channel modulatory subunit
    • Cardiac voltage-gated potassium channel modulatory subunit
    • DKFZp566L1246
    • KChIP 2
    • KChIP2
    • KCIP2_HUMAN
    • KCNIP 2
    • Kcnip2
    • Kv channel interacting protein 2
    • Kv channel-interacting protein 2
    • MGC17241
    • Potassium channel interacting protein 2
    • Potassium channel-interacting protein 2
    see all
  • Function

    Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart.
  • Tissue specificity

    Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart.
  • Sequence similarities

    Belongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Post-translational
    modifications

    Palmitoylated. Palmitoylation enhances association with the plasma membrane.
  • Cellular localization

    Cell membrane and Cell membrane. Detected on lipid rafts (By similarity).
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131900 stained with Coomassie Blue.

References

ab131900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up