Description

  • Product name

    Recombinant Human KCNE1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMV LGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL ESYRS
    • Amino acids

      1 to 105
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Delayed rectifier potassium channel subunit IsK
    • Human cardiac delayed rectifier potassium channel protein
    • IKs producing slow voltage gated potassium channel subunit beta Mink
    • IKs producing slow voltage-gated potassium channel subunit beta Mink
    • ISK
    • JLNS
    • JLNS 2
    • JLNS2
    • KCNE 1
    • KCNE1
    • KCNE1_HUMAN
    • LQT 5
    • LQT5
    • MGC33114
    • Minimal potassium channel
    • MinK
    • Potassium voltage gated channel Isk related family member 1
    • Potassium voltage gated channel Isk related subfamily member 1
    • Potassium voltage gated channel subfamily E member 1
    • Potassium voltage-gated channel subfamily E member 1
    see all
  • Function

    Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
  • Tissue specificity

    Expressed in heart, lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.
  • Involvement in disease

    Jervell and Lange-Nielsen syndrome 2 (JLNS2) [MIM:612347]: An autosomal recessive disorder characterized by congenital deafness, prolongation of the QT interval, syncopal attacks due to ventricular arrhythmias, and a high risk of sudden death. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Long QT syndrome 5 (LQT5) [MIM:613695]: A heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the potassium channel KCNE family.
  • Post-translational
    modifications

    Phosphorylation inhibits the potassium current.
    N-glycosylation at Asn-26 occurs post-translationally, and requires prior cotranslational glycosylation at Asn-5.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158781 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up