Overview

  • Product name
    Recombinant Human KCNF1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLA ELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHM KKGICPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILD DLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMC MGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHF ALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHP ETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIAL PIHPIINNFVRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLD NLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK
    • Amino acids
      1 to 494
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IK 8
    • IK8
    • KCNF
    • KCNF 1
    • Kcnf1
    • KCNF1_HUMAN
    • kH 1
    • kH1
    • KV5.1
    • MGC33316
    • Potassium channel KH1
    • Potassium channel Kv5.1
    • Potassium channel, voltage-gated, subfamily F, member 1
    • Potassium voltage gated channel subfamily F member 1
    • Potassium voltage-gated channel subfamily F member 1
    • Voltage gated potassium channel subunit Kv5.1
    • Voltage-gated potassium channel subunit Kv5.1
    see all
  • Function
    Putative voltage-gated potassium channel.
  • Tissue specificity
    Detected in heart, brain, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the potassium channel family. F (TC 1.A.1.2) subfamily. Kv5.1/KCNF1 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158783 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up