Overview

  • Product name
    Recombinant Human KCNG3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGF ILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS
    • Amino acids
      23 to 121
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KCNG 3
    • Kcng3
    • KCNG3_HUMAN
    • KV10.1
    • Kv10.1a
    • Kv10.1b
    • KV6.3
    • OTTHUMP00000201478
    • OTTHUMP00000201479
    • Potassium voltage gated channel subfamily G member 3
    • Potassium voltage-gated channel subfamily G member 3
    • Voltage gated potassium channel 6.3
    • Voltage gated potassium channel Kv10.1
    • Voltage gated potassium channel subunit Kv10.1
    • Voltage gated potassium channel subunit Kv6.3
    • Voltage gated potassium channel subunit Kv6.4
    • Voltage-gated potassium channel subunit Kv10.1
    • Voltage-gated potassium channel subunit Kv6.3
    see all
  • Function
    Potassium channel subunit. Modulates channel activity.
  • Tissue specificity
    Detected in many parts of the brain with the exception of the cerebellum, in testis, pancreas, lung, kidney, ovary, small intestine, colon, thymus, adrenal gland and spinal cord.
  • Sequence similarities
    Belongs to the potassium channel family. G (TC 1.A.1.2) subfamily. Kv6.3/KCNG3 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Cell membrane. Membrane. Has to be associated with KCNB1 or possibly another partner to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB1.
  • Information by UniProt

Images

  • ab165821 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up