Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPTVYLCSEQIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIE FGNVEAQSRFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAV AYIHKDLPEFHPSANHTPCVENINGLTSAFLFSLETQVTIGYGFRCVTEQ CATAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISK RGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFV VDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVE STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVET PHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 389

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP regulated potassium channel ROM K
    • ATP sensitive inward rectifier potassium channel 1
    • ATP-regulated potassium channel ROM-K
    • ATP-sensitive inward rectifier potassium channel 1
    • Inward rectifier K(+) channel Kir1.1
    • inwardly rectifying K+ channel
    • inwardly rectifying subfamily J member 1
    • IRK1_HUMAN
    • KCNJ
    • KCNJ 1
    • Kcnj1
    • Kir 1.1
    • Kir1.1
    • OTTHUMP00000045938
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 1
    • potassium inwardly-rectifying channel J1
    • ROMK
    • ROMK 1
    • ROMK 2
    • ROMK1
    • ROMK2
    see all
  • Function

    In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.
  • Tissue specificity

    In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.
  • Involvement in disease

    Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) [MIM:241200]; also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ1 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132854 stained with Coomassie Blue.

References

ab132854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up