Overview

  • Product name

    Recombinant Human KCNJ5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEM KREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
    • Amino acids

      321 to 419
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cardiac ATP sensitive potassium channel
    • Cardiac inward rectifier
    • CIR
    • G protein activated inward rectifier potassium channel 4
    • G protein-activated inward rectifier potassium channel 4
    • GIRK 4
    • GIRK-4
    • GIRK4
    • Heart KATP channel
    • Inward rectifier K(+) channel Kir3.4
    • Inward rectifier K+ channel KIR3.4
    • Inward rectifier potassium channel KIR3.4
    • inwardly rectifying subfamily J member 5
    • IRK-4
    • IRK5_HUMAN
    • KATP 1
    • KATP-1
    • KATP1
    • KCNJ 5
    • Kcnj5
    • KIR 3.4
    • KIR3.4
    • LQT13
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 5
    • Potassium inwardly rectifying channel J5
    • Potassium inwardly rectifying channel subfamily J member 5
    • potassium voltage-gated channel subfamily J member 5
    see all
  • Function

    This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
  • Tissue specificity

    Islets, exocrine pancreas and heart.
  • Involvement in disease

    Defects in KCNJ5 are the cause of long QT syndrome type 13 (LQT13) [MIM:613485]. It is a heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to excercise or emotional stress, and can present with a sentinel event of sudden cardiac death in infancy.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ5 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158786 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up