Overview

  • Product name

    Recombinant Human KCNK18/TRESK protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVL VAADDGEFEKFLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTH WSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTD TGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVP QIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERS NSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEI VFIAFKLVQNRLIDIYKNVMLFFAKGKFYHLVKK
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 384

Specifications

Our Abpromise guarantee covers the use of ab132696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • K2p18.1
    • KCNK18
    • KCNKI_HUMAN
    • MGR13
    • OTTHUMP00000020575
    • Potassium channel subfamily K member 18
    • TRESK
    • TRESK 2
    • TRESK2
    • TRIK
    • TWIK related individual K+ channel
    • TWIK related individual potassium channel
    • TWIK related spinal cord K+ channel
    • TWIK related spinal cord potassium channel
    • TWIK-related individual potassium channel
    • TWIK-related spinal cord potassium channel
    see all
  • Function

    Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. May function as background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signal. Activated by the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel via calcineurin, whereas the anchoring of 14-3-3/YWHAH interferes with the return of the current to the resting state after activation. Inhibited also by arachidonic acid and other naturally occurring unsaturated free fatty acids. Channel activity is also enhanced by volatile anesthetics, such as isoflurane. Appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Schezuan pepper. May be involved in the somatosensory function with special respect to pain sensation.
  • Tissue specificity

    Expressed specifically in dorsal root ganglion and trigeminal ganglion neurons. Detected at low levels in spinal cord.
  • Involvement in disease

    Defects in KCNK18 are a cause of migraine with or without aura type 13 (MGR13) [MIM:613656]. A form of migraine trasmitted in an autosomal dominant pattern. Migraine is a disabling symptom complex of periodic headaches, usually temporal and unilateral. Headaches are often accompanied by irritability, nausea, vomiting and photobia, preceded by constriction of the cranial arteries. The two major subtypes are common migraine (migraine without aura) and classic migraine (migraine with aura). Classic migraine is characterized by recurrent attacks of reversible neurological symptoms (aura) that precede or accompany the headache. Aura may include a combination of sensory disturbances, such as blurred vision, hallucinations, vertigo, numbness and difficulty in concentrating and speaking. Note=Susceptibility to migraine has been shown to be conferred by a frameshift mutation that segregates with the disorder in a large multigenerational family. Migraine was associated with sensitivity to lights, sounds, and smells, as well as nausea and occasional vomiting. Triggers included fatigue, alcohol and bright lights. Mutations in KCNK18 are a rare cause of migraine.
  • Sequence similarities

    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Post-translational
    modifications

    Phosphorylation of Ser-252 is required for the binding of 14-3-3eta/YWHAH. Calcineurin-mediated dephosphorylation of Ser-264 enhances channel activity.
    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132696 stained with Coomassie Blue.

References

ab132696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up