Description

  • Product name

    Recombinant Human KCNK1/TWIK1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKED QKQNEPFVATQSSACVDGPANH
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      265 to 336

Specifications

Our Abpromise guarantee covers the use of ab116746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.

     This product was previously labelled as KCNK1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names

    • DPK
    • HOHO
    • HOHO1
    • inward rectifying potassium channel protein TWIK 1
    • Inward rectifying potassium channel protein TWIK-1
    • Inward rectifying potassium channel protein TWIK1
    • K2P1
    • K2p1.1
    • KCNK1
    • KCNK1_HUMAN
    • KCNO1
    • OTTHUMP00000036029
    • Potassium channel KCNO1
    • Potassium channel subfamily K member 1
    • Potassium inwardly rectifying channel subfamily K member 1
    • TWIK 1
    • TWIK1
    see all
  • Function

    Weakly inward rectifying potassium channel.
  • Tissue specificity

    Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney.
  • Sequence similarities

    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab116746 at approximately 33.55kDa, stained with Coomassie Blue.

References

ab116746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up