Overview

  • Product name

    Recombinant Human KCNK5/TASK2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFP CLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIG YGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTK RGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFIT ISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFV EVHKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEET YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKN RVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISE ECEPWDAQDYHPLIFQDASITFVNTEAGLSDEETSKSSLEDNLAGEESPQ QGAEAKAPLNMGEFPSSSESTFTSTESELSVPYEQLMNEYNKANSPKGT
    • Amino acids

      1 to 499
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as KCNK5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acid sensitive potassium channel protein TASK 2
    • Acid-sensitive potassium channel protein TASK-2
    • FLJ11035
    • K2p5.1
    • KCNK 5
    • KCNK5
    • KCNK5_HUMAN
    • Potassium channel subfamily K member 1
    • Potassium channel subfamily K member 5
    • TASK 2
    • TASK2
    • TWIK related acid sensitive K(+) channel 2
    • TWIK related acid sensitive K+ channel 2
    • TWIK-related acid-sensitive K(+) channel 2
    see all
  • Function

    pH-dependent, voltage insensitive, outwardly rectifying potassium channel. Outward rectification is lost at high external K(+) concentrations.
  • Tissue specificity

    Abundant expression in kidney, also detected in liver, placenta and small intestine. In the kidney, expression is restricted to the distal tubules and collecting ducts. Not expressed in proximal tubules or glomeruli.
  • Sequence similarities

    Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160135 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up