Description

  • Product name

    Recombinant Human KCNMB2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILL GLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFS CGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGK NFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSL FWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
    • Amino acids

      1 to 235
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2700049B16Rik
    • 3110031N04Rik
    • BK channel subunit beta 2
    • BK channel subunit beta-2
    • BKbeta2
    • Calcium activated potassium channel subfamily M subunit beta 2
    • Calcium activated potassium channel subunit beta 2
    • Calcium-activated potassium channel
    • Calcium-activated potassium channel subunit beta-2
    • Charybdotoxin receptor subunit beta 2
    • Charybdotoxin receptor subunit beta-2
    • Hbeta2
    • Hbeta3
    • K(VCA)beta-2
    • K(VCA)beta2
    • KCMB2_HUMAN
    • KCNMB 2
    • Kcnmb2
    • Large conductance Ca2+ activated K+ channel beta2 subunit
    • Large conductance calcium activated potassium channel beta 2 subunit
    • Maxi K channel subunit beta 2
    • Maxi K channel subunit beta-2
    • MaxiK channel beta 2 subunit
    • MGC22431
    • MGC57945
    • Potassium large conductance calcium activated channel subfamily M beta member 2
    • Slo-beta-2
    • Slobeta2
    • subfamily M subunit beta-2
    see all
  • Function

    Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and complete inactivation of KCNMA1 channel complex. May participate in KCNMA1 inactivation in chromaffin cells of the adrenal gland or in hippocampal CA1 neurons.
  • Tissue specificity

    Expressed in kidney, heart and brain. Highly expressed in ovary. Expressed at low level in other tissues.
  • Sequence similarities

    Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB2 subfamily.
  • Domain

    The ball and chain domain mediates the inactivation of KCNMA1. It occludes the conduction pathway of KCNMA1 channels, and comprises the pore-blocking ball domain (residues 1-17) and the chain domain (residues 20-45) linking it to the transmembrane segment. The ball domain is made up of a flexible N-terminus anchored at a well ordered loop-helix motif. The chain domain consists of a 4-turn helix with an unfolded linker at its C-terminus.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160899 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160899 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up