Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLS HPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG
    • Amino acids
      82 to 181
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BK channel subunit beta 3
    • BK channel subunit beta-3
    • BKbeta 3
    • BKbeta3
    • Calcium activated potassium channel beta 3 subunit
    • Calcium activated potassium channel subfamily M subunit beta 3
    • Calcium activated potassium channel subunit beta 3
    • Calcium-activated potassium channel
    • Calcium-activated potassium channel subunit beta-3
    • Charybdotoxin receptor subunit beta 3
    • Charybdotoxin receptor subunit beta-3
    • EG435726
    • Gm5707
    • Hbeta 3
    • Hbeta3
    • K(VCA)beta 3
    • K(VCA)beta-3
    • KCMB3_HUMAN
    • KCNMB 2
    • KCNMB 3
    • KCNMB2
    • KCNMB3
    • KCNMBL
    • Large conductance voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit
    • Maxi K channel subunit beta 3
    • Maxi K channel subunit beta-3
    • Potassium channel, calcium-activated large conductance, subfamily M, beta member 3
    • Potassium large conductance calcium activated channel beta 3 subunit
    • Potassium large conductance calcium activated channel subfamily M beta member 3
    • Slo beta 3
    • Slo-beta-3
    • subfamily M subunit beta-3
    see all
  • Function
    Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Alters the functional properties of the current expressed by the KCNMA1 channel. Isoform 2, isoform 3 and isoform 4 partially inactivate the current of KCNBMA. Isoform 4 induces a fast and incomplete inactivation of KCNMA1 channel that is detectable only at large depolarizations. In contrast, isoform 1 does not induce detectable inactivation of KCNMA1. Two or more subunits of KCNMB3 are required to block the KCNMA1 tetramer.
  • Tissue specificity
    Isoform 1, isoform 3 and isoform 4 are widely expressed. Isoform 2 is expressed placenta, pancreas, kidney and heart. Isoform 1 and isoform 3 are highly expressed in pancreas and testis.
  • Sequence similarities
    Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB3 subfamily.
  • Domain
    Isoform 4 cytoplasmic N-terminal domain participates in the partial inactivation of KCNMA1, possibly by binding to a receptor site.
    The extracellular domain forms gates to block ion permeation, providing a mechanism by which current can be rapidly diminished upon cellular repolarization.
  • Post-translational
    modifications
    N-glycosylated.
    The extracellular domain contains disulfide bond essential for the gating mechanism.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162077 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162077 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up