Description

  • Product name

    Recombinant Human KCNMB4 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQAT EANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALL HSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEIGSQPFTCYF NQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVK AEAMKKRKFS
    • Amino acids

      1 to 210
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BK channel subunit beta 4
    • BK channel subunit beta-4
    • BKbeta4
    • Calcium activated potassium channel beta 4 subunit
    • Calcium activated potassium channel subfamily M subunit beta 4
    • Calcium activated potassium channel subunit beta 4
    • Calcium-activated potassium channel
    • Calcium-activated potassium channel subunit beta-4
    • Charybdotoxin receptor subunit beta 4
    • Charybdotoxin receptor subunit beta-4
    • Hbeta4
    • K(VCA)beta 4
    • K(VCA)beta-4
    • KCMB4_HUMAN
    • KCNMB 4
    • Kcnmb4
    • Large conductance calcium dependent potassium ion channel beta 4 subunit
    • Maxi K channel subunit beta 4
    • Maxi K channel subunit beta-4
    • Potassium large conductance calcium activated channel subfamily M beta member 4
    • Slo beta 4
    • Slo-beta-4
    • subfamily M subunit beta-4
    see all
  • Function

    Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.
  • Tissue specificity

    Predominantly expressed in brain. In brain, it is expressed in the cerebellum, cerebral cortex, medulla, spinal cord, occipital pole, frontal lobe, temporal lobe, putamen, amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra and thalamus. Weakly or not expressed in other tissues.
  • Sequence similarities

    Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB4 subfamily.
  • Domain

    Resistance to charybdotoxin (CTX) toxin is mediated by the extracellular domain.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation modulates its effect on KCNMA1 activation kinetics.
    N-glycosylated. A highly glycosylated form is promoted by KCNMA1. Glycosylation, which is not required for the interaction with KCNMA1 and subcellular location, increases protection against charybdotoxin.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab153296 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up