Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMI LYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
    • Amino acids

      328 to 427
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DHS2
    • hIKCa1
    • hKCa4
    • hSK4
    • IK
    • IK1
    • IKCa1
    • Intermediate conductance calcium activated potassium channel protein 4
    • Intermediate conductance calcium-activated potassium channel protein 4
    • KCa3.1
    • KCa4
    • KCNN 4
    • Kcnn4
    • KCNN4_HUMAN
    • Potassium calcium activated channel subfamily N member 4
    • Potassium intermediate/small conductance calcium activated channel, subfamily N, member 4
    • Putative Gardos channel
    • SK4
    • SKCa 4
    • SKCa4
    see all
  • Function

    Forms a voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T cells. The channel is blocked by clotrimazole and charybdotoxin but is insensitive to apamin.
  • Tissue specificity

    Widely expressed in non-excitable tissues.
  • Sequence similarities

    Belongs to the potassium channel KCNN family. KCa3.1/KCNN4 subfamily.
  • Post-translational
    modifications

    Phosphorylation at His-358 by NDKB activates the channel, and conversely it's dephosphorylation by PHPT1 inhibits the channel.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158789 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up