Overview

  • Product name

    Recombinant Human KCNQ2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKR GSILSKPRAGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVF LLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGC CCRYRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSL RFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLV YLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATN LSRTDLHSTWQYYERTVTVPMYRYRRRAPATKQLFHFLFSICS
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 393

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BFNC
    • BFNS1
    • EBN
    • EBN 1
    • EBN1
    • EIEE7
    • ENB 1
    • ENB1
    • HNSPC
    • KCNA 11
    • KCNA11
    • KCNQ 2
    • Kcnq2
    • KCNQ2_HUMAN
    • KQT like 2
    • KQT-like 2
    • KV7.2
    • KVEBN 1
    • KVEBN1
    • KvLQT 2
    • KvLQT2
    • Neuroblastoma specific potassium channel alpha subunit KvLQT2
    • Neuroblastoma specific potassium channel protein
    • Neuroblastoma specific potassium channel subunit alpha
    • Neuroblastoma specific potassium channel subunit alpha KvLQT2
    • Neuroblastoma-specific potassium channel subunit alpha KvLQT2
    • OTTHUMP00000031681
    • OTTHUMP00000031682
    • OTTHUMP00000031684
    • OTTHUMP00000031685
    • OTTHUMP00000031686
    • OTTHUMP00000031687
    • OTTHUMP00000031689
    • Potassium voltage gated channel KQT like protein 2
    • Potassium voltage gated channel KQT like subfamily member 2
    • Potassium voltage gated channel subfamily KQT member 2
    • Potassium voltage-gated channel subfamily KQT member 2
    • Voltage gated potassium channel subunit Kv7.2
    • Voltage-gated potassium channel subunit Kv7.2
    see all
  • Function

    Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. KCNQ2/KCNQ3 current is blocked by linopirdine and XE991, and activated by the anticonvulsant retigabine. Muscarinic agonist oxotremorine-M strongly suppress KCNQ2/KCNQ3 current in cells in which cloned KCNQ2/KCNQ3 channels were coexpressed with M1 muscarinic receptors.
  • Tissue specificity

    In adult and fetal brain. Highly expressed in areas containing neuronal cell bodies, low in spinal chord and corpus callosum. Isoform 2 is preferentially expressed in differentiated neurons. Isoform 6 is prominent in fetal brain, undifferentiated neuroblastoma cells and brain tumors.
  • Involvement in disease

    Defects in KCNQ2 are the cause of benign familial neonatal seizures type 1 (BFNS1) [MIM:121200]. A disorder characterized by clusters of seizures occurring in the first days of life. Most patients have spontaneous remission by 12 months of age and show normal psychomotor development. Some rare cases manifest an atypical severe phenotype associated with epileptic encephalopathy and psychomotor retardation. The disorder is distinguished from benign familial infantile seizures by an earlier age at onset. In some patients, neonatal convulsions are followed later in life by myokymia, a benign condition characterized by spontaneous involuntary contractions of skeletal muscles fiber groups that can be observed as vermiform movement of the overlying skin. Electromyography typically shows continuous motor unit activity with spontaneous oligo- and multiplet-discharges of high intraburst frequency (myokymic discharges). Some patients may have isolated myokymia.
    Defects in KCNQ2 are the cause of epileptic encephalopathy early infantile type 7 (EIEE7) [MIM:613720]. EIEE7 is an autosomal dominant seizure disorder characterized by infantile onset of refractory seizures with resultant delayed neurologic development and persistent neurologic abnormalities.
  • Sequence similarities

    Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.2/KCNQ2 sub-subfamily.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Post-translational
    modifications

    In Xenopus oocytes KCNQ2/KCNQ3 heteromeric current can be increased by intracellular cyclic AMP, an effect that depends on phosphorylation of Ser-52 in the N-terminus region.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132148 on a 12.5% gel stained with Coomassie Blue.

References

ab132148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up