Description

  • Product name

    Recombinant Human KCNQ4 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLR SGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
    • Amino acids

      596 to 695
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DFNA 2
    • DFNA2
    • KCNQ 4
    • Kcnq4
    • KCNQ4_HUMAN
    • KQT like 4
    • KQT-like 4
    • KV7.4
    • Potassium channel KQT like 4
    • Potassium channel subunit alpha KvLQT4
    • Potassium voltage gated channel KQT like protein 4
    • Potassium voltage gated channel KQT like subfamily member 4
    • Potassium voltage gated channel subfamily KQT member 4
    • Potassium voltage-gated channel subfamily KQT member 4
    • Voltage gated potassium channel subunit Kv7.4
    • Voltage-gated potassium channel subunit Kv7.4
    see all
  • Function

    Probably important in the regulation of neuronal excitability. May underlie a potassium current involved in regulating the excitability of sensory cells of the cochlea. KCNQ4 channels are blocked by linopirdin, XE991 and bepridil, whereas clofilium is without significant effect. Muscarinic agonist oxotremorine-M strongly suppress KCNQ4 current in CHO cells in which cloned KCNQ4 channels were coexpressed with M1 muscarinnic receptors.
  • Tissue specificity

    Expressed in the outer, but not the inner, sensory hair cells of the cochlea. Slightly expressed in heart, brain and skeletal muscle.
  • Involvement in disease

    Defects in KCNQ4 are the cause of deafness autosomal dominant type 2A (DFNA2A) [MIM:600101]. DFNA2A is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.4/KCNQ4 sub-subfamily.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
    The A-domain tail carries the major determinants of channel assembly specificity. Its coiled-coil region is Four-stranded.
  • Cellular localization

    Basal cell membrane. Situated at the basal membrane of cochlear outer hair cells.
  • Information by UniProt

Images

  • ab152953 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up