Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMERKINRREKEKEYEGKHNSLEDTDQG KNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHY FIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVK SRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSK SRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEA IMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No. NP_940686.

Specifications

Our Abpromise guarantee covers the use of ab174560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab174560 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • bA321C24.3
    • BTB/POZ domain containing protein KCTD4
    • KCTD 4
    • OTTHUMP00000018343
    • Potassium channel tetramerisation domain containing 4
    see all
  • Relevance
    KCTD4 contains a potassium channel tetramerisation domain. The N terminal, cytoplasmic tetramerisation domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily specific assembly of alpha subunits into functional tetrameric channels. The specific function of KCTD4 is unknown.

Images

  • 15% SDS-PAGE analysis of ab174560 (3 µg)

References

ab174560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up