Overview

  • Product name

    Recombinant Human KCTD5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAENHCELLSPARGGIGAGLGGGLCRR CSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQAD PDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAE FYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSD GWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKIL QERGSRM
    • Molecular weight

      29 kDa including tags
    • Amino acids

      1 to 234
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab137135 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • BTB/POZ domain-containing protein KCTD5
    • FLJ20040
    • KCTD5
    • KCTD5_HUMAN
    • Potassium channel tetramerisation domain containing 5
    see all
  • Function

    Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex. Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4.
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
  • Domain

    The BTB (POZ) domain is atypical and mediates the formation of a homopentamer instead of a homotetramer. Homopentamerization is due to the presence of 4 residues in the BTB (POZ) domain: Leu-56, Gly-100, Val-112 and Ala-118.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Predominantly cytoplasmic, translocated to the nucleus upon interaction with Rep proteins.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137135.

References

ab137135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up