Overview

  • Product name

    Recombinant Human KDELR3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLD LFTNFISIYNTVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLV PVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISKTGEAETITTH YLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVT KVLKGKKLSLPMPI
    • Amino acids

      1 to 214
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ER lumen protein retaining receptor 3
    • ERD2L3
    • KDEL (Lys Asp Glu Leu) endoplasmic reticulum protein retention receptor 3
    • KDEL endoplasmic reticulum protein retention receptor 3
    • KDEL receptor 3
    • KDELR 3
    see all
  • Relevance

    KDELR3 is required for the retention of luminal endoplasmic reticulum proteins. It determines the specificity of the luminal ER protein retention system and is also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.
  • Cellular localization

    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab161242 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up