Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEV GPGAVGERTPRKKEPPRASPPGGLAEPQGSAGPQAGPTVVPGSATPMETG IAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKK LPPPPPQAPPEEENESEPEEPSGQAGGLQDDSSGGYGDGQASGVEGAAFQ SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLT FEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGK VIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLG AMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQADTVKVPKEKDE MVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDE QIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITA EFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDR QILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPV ALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLP LGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVN LFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGR CLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLM AQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIA DQFLGAMYTLPRQATPGVPAQQSPSM
    • Molecular weight

      122 kDa including tags
    • Amino acids

      1 to 876
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/mL.

    Best used within three months from the date of receipt.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amine oxidase (flavin containing) domain 2
    • Amine oxidase, flavin containing, 2
    • AOF2
    • BHC110
    • BRAF35 HDAC complex protein BHC110
    • BRAF35-HDAC complex protein BHC110
    • BRAF35/HDAC complex, 110-kD subunit
    • CPRF
    • EC1
    • FAD binding protein BRAF35 HDAC complex, 110 kDa subunit
    • Flavin-containing amine oxidase domain-containing protein 2
    • KDM 1
    • KDM1
    • Kdm1a
    • KDM1A_HUMAN
    • KIAA0601
    • LSD 1
    • LSD1
    • Lysine (K) specific demethylase 1
    • Lysine (K) specific demethylase 1A
    • Lysine demethylase 1A
    • Lysine specific histone demethylase 1
    • Lysine specific histone demethylase 1A
    • Lysine-specific demethylase 1
    • Lysine-specific demethylase 1A
    • Lysine-specific histone demethylase 1A
    see all
  • Function

    Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me. May play a role in the repression of neuronal genes. Alone, it is unable to demethylate H3K4me on nucleosomes and requires the presence of RCOR1/CoREST to achieve such activity. Also acts as a coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and mediating demethylation of H3K9me, a specific tag for epigenetic transcriptional repression. The presence of PRKCB in ANDR-containing complexes, which mediates phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag that prevents demethylation H3K4me, prevents H3K4me demethylase activity of KDM1A. Demethylates di-methylated 'Lys-370' of p53/TP53 which prevents interaction of p53/TP53 with TP53BP1 and represses p53/TP53-mediated transcriptional activation. Demethylates and stabilizes the DNA methylase DNMT1. Required for gastrulation during embryogenesis.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the flavin monoamine oxidase family.
    Contains 1 SWIRM domain.
  • Domain

    The SWIRM domain may act as an anchor site for a histone tail.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132186 stained with Coomassie Blue.

References

ab132186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up