Description

  • Product name

    Recombinant human KDM2B protein
    See all KDM2B proteins and peptides
  • Biological activity

    Enzyme was incubated with 0.4 μM substrate in HEPES-containing JMJ assay buffer SA and SA- (without KG) in a 10-μl reaction for 180 min at 30°C. 5 μl of Anti-Rabbit acceptor beads (1:250) and 5 μl of rabbit polyclonal antibody (1:200) were added and incubation continued for 30 min. Streptavidin Donor beads (1:125) were added (10 μl) and mixture was further incubated for 10 min at RT before counts were measured.

  • Purity

    70 - 90% by HPLC.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQRPIDRQRY DENEDLSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKDFNYEYVQRE ALRVPLIFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTE MSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVD NMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSV WYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIEL KQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRV QPKFRYPFYYEMCWYVLERYVYCVTQRSHLTQEYQRESMLIDAPRKPSID GFSSDSWLEMEEEACDQQPQEEEEKDEEGEGRDRAPKPPTDGSTSPTSTP SEDQEALGKKPKAPALRFLKRTLSNESEESVKSTTLAVDYPKTPTGSPAT EVSAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKN VLKEHADDDPSLAITGVPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAAN RTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQ
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 650
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      GenBank Accession No.: NM_032590

Specifications

Our Abpromise guarantee covers the use of ab196435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • [Histone-H3]-lysine-36 demethylase 1B
    • CXXC-type zinc finger protein 2
    • CXXC2
    • F box and leucine rich repeat protein 10
    • F box protein FBL10
    • F-box and leucine-rich repeat protein 10
    • F-box protein FBL10
    • F-box/LRR-repeat protein 10
    • Fbl10
    • FBXL10
    • JEMMA (Jumonji domain EMSY interactor methyltransferase motif) protein
    • JHDM1B
    • JmjC domain-containing histone demethylation protein 1B
    • Jumonji C domain containing histone demethylase 1B
    • Jumonji domain-containing EMSY-interactor methyltransferase motif protein
    • kdm2b
    • KDM2B_HUMAN
    • Lysine (K) specific demethylase 2B
    • Lysine-specific demethylase 2B
    • PCCX2
    • Protein containing CXXC domain 2
    • Protein JEMMA
    • Protein-containing CXXC domain 2
    see all
  • Function

    Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Sequence similarities

    Belongs to the JHDM1 histone demethylase family.
    Contains 1 CXXC-type zinc finger.
    Contains 1 F-box domain.
    Contains 1 JmjC domain.
    Contains 7 LRR (leucine-rich) repeats.
    Contains 1 PHD-type zinc finger.
  • Domain

    The JmjC domain mediates demethylation activity (By similarity). It is also required for repression of ribosomal RNA genes.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 2.4 μg of ab196435 on a 4-20% SDS gel stained with Coomassie.

  • SDS-PAGE analysis of 2.8 μg of ab196435 on a 4-20% SDS gel stained with Coomassie.

  • Specific activity of ab196435

References

ab196435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up