Overview

  • Product name

    Recombinant human KDM3A / JHDM2A protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      VLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAV SHTDVTKKDLKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKS PEISERIVQWPAITYKPLLDKAGLGSITSVRFLGDQQRVFLSKDLLKPIQ DVNSLRLSLTDNQIVSKEFQALIVKHLDESHLLKGDKNLVGSEVKIYSLD PSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIHVEVVHDNLVTC GNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEIL LGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLN TKSEALRTKPDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQEN RLESVPQALTGLPKECLPTKASSKAELEIANPPELQKHLEHAPSPSDVSN APEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVKVDNESCCSRSN NKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIVAQLPKCRECRL DSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAIG LWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAW KRAVKGVREMCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAY KTFSWLKCVKSQIHEPENLMPTQIIPGKALYDVGDIVHSVRAKWGIKANC PCSNRQFKLFSKPASKEDLKQTSLAGEKPTLGAVLQQNPSVLEPAAVGGE AASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQPTMPILKNEIK CLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLK NTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRL LCLQDPNNKSNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGE QEVDLVNCRTNEIITGATVGDFWDGFEDVPNRLKNEKEPMVLKLKDWPPG EDFRDMMPSRFDDLMANIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMY NAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQCEQEEEVLKTIQ DGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQENP ADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQV HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY HAVKDAVAMLKASESSFGKP
    • Molecular weight

      148 kDa including tags
    • Amino acids

      2 to 1321
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    0.3 pmole/min/μg: 10µl reaction mix containing assay buffer with 20 mM Tris (pH 7.4), 150 mM NaCl, 500 µM α-ketoglutarate, 25 µM iron, 2mM ascorbic acid, 0.01% Tween-20, 0.5 µM biotinylated peptide substrate, and ab196411 (20 – 100 ng) added to the wells. Add antibody against mono-methylated K9 peptide. Incubate for 30 min, then Streptavidin-conjugated secondary antibody followed by Alpha Screening detection.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    >= 27 % SDS-PAGE.
    ab196411 is greater or equal to 27% pure as assessed by SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol

    contains 90ng/ml DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DKFZp686A24246
    • DKFZp686P07111
    • JHDM2A
    • JHMD2A
    • JmjC domain-containing histone demethylation protein 2A
    • JMJD1
    • JMJD1A
    • Jumonji C domain containing histone demethylase 2A
    • Jumonji domain containing 1
    • Jumonji domain containing 1A
    • Jumonji domain containing protein 1A
    • Jumonji domain-containing protein 1A
    • Kdm3a
    • KDM3A_HUMAN
    • KIAA0742
    • Lysine (K) specific demethylase 3A
    • Lysine-specific demethylase 3A
    • Testis specific protein A
    • TSGA
    see all
  • Function

    Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Preferentially demethylates mono- and dimethylated H3 'Lys-9' residue, with a preference for dimethylated residue, while it has weak or no activity on trimethylated H3 'Lys-9'. Demethylation of Lys residue generates formaldehyde and succinate. Involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes, resulting in H3 'Lys-9' demethylation and transcriptional activation. Involved in spermatogenesis by regulating expression of target genes such as PRM1 and TMP1 which are required for packaging and condensation of sperm chromatin. Involved in obesity resistance through regulation of metabolic genes such as PPARA and UCP1.
  • Sequence similarities

    Belongs to the JHDM2 histone demethylase family.
    Contains 1 JmjC domain.
  • Domain

    The JmjC domain and the C6-type zinc-finger are required for the demethylation activity.
    Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs are known to mediate the association with nuclear receptors.
  • Cellular localization

    Cytoplasm. Nucleus. Nuclear in round spermatids. When spermatids start to elongate, localizes to the cytoplasm where it forms distinct foci which disappear in mature spermatozoa.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab196411 at 1.6 µg stained with Coomassie Blue.

  • Example of specific activity of ab196411

References

ab196411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up