Recombinant Human KDM4D / JMJD2D protein (ab163180)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      METMKSKANCAQNPNCNIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAK IIPPKEWKARETYDNISEILIATPLQQVASGRAGVFTQYHKKKKAMTVGE YRHLANSKKYQTPPHQNFEDLERKYWKNRIYNSPIYGADISGSLFDENTK QWNLGHLGTIQDLLEKECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYS INYLHLGEPKTWYVVPPEHGQRLERLARELFPGSSRGCGAFLRHKVALIS PTVLKENGIPFNRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRW IDYGKMASQCSCGEARVTFSMDAFVRILQPERYDLWKRGQDRAVVDHMEP RVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSPWPMAARSGTRCHTL VCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSNGR RGRGRPPQKLRAQELTLQTPAKRPLLAGTTCTASGPEPEPLPEDGALMDK PVPLSPGLQHPVKASGCSWAPVP
    • Amino acids
      1 to 523
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • JHD3D
    • JHDM3D
    • JmjC domain-containing histone demethylation protein 3D
    • Jumonji domain-containing protein 2D
    • Kdm4d
    • KDM4D_HUMAN
    • Lysine-specific demethylase 4D
    see all
  • Function
    Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Demethylates both di- and trimethylated H3 'Lys-9' residue, while it has no activity on monomethylated residues. Demethylation of Lys residue generates formaldehyde and succinate.
  • Sequence similarities
    Belongs to the JHDM3 histone demethylase family.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163180 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up