Description

  • Product name

    Recombinant human KDM4E protein
  • Biological activity

    Specific activity: 0.14 pmole/min/μg.

     

    10µl reaction mix containing assay buffer with 20 mM HEPES (pH 7.4), 150 mM NaCl, 500 µM α-ketoglutarate, 25 µM iron, 2mM ascorbic acid, 0.01% Tween-20, 0.5 µM biotinylated peptide substrate, and ab196415 (100 – 400 ng) added to the wells. Add antibody against demethylated K9 peptide. Incubate for 30 min, then Streptavidin-conjugated secondary antibody followed by detection.

  • Purity

    >= 37 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPP KEWKARQMYDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRL ANSKKYQTPPHQNFADLEQRYWKSHPGNPPIYGADISGSLFEESTKQWNL GHLGTILDLLEQECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYL HFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLRHKVALISPTVL KENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYG KMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQ
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      2 to 337
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_001161630.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab196415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.49% Glutathione

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • JMJD2E
    • KDM4D-like protein
    • KDM4DL
    • lysine (K)-specific demethylase 4E
    • Lysine specific demethylase 4E
    see all
  • Relevance

    Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code.
  • Cellular localization

    Nuclear

Images

  • 10% SDS-PAGE analysis of ab196415 with Coomassie staining.

  • Activity assay of ab196415.

References

ab196415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up