Overview

  • Product name

    Recombinant human KDM5A / Jarid1A / RBBP2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICK IRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWEL QGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLP GKGTGSLLKSHYERILYPYELFQSGVSLMGVQMPNLDLKEKVEPEVLSTD TQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVG LAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPRE AFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSS IEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEP KTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGV PVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLR ESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCL YHPTDLCPCPMQKKCLRYRYPLEDLPSLLYGVKVRAQSYDTWVSRVTEAL SANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQL LLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLL DDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLT VSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQK AREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAA RAWRERTGRTFLKKNSSHTLLQVLSPRTDIGVYGSGKNRR
    • Molecular weight

      125 kDa including tags
    • Amino acids

      1 to 1090
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      NM_001042603.

Specifications

Our Abpromise guarantee covers the use of ab198108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 0.027 pmole/min/μg

    Assay Conditions: 10 µl reaction mix containing assay buffer with 20 mM Tris (pH 7.4), 50 mM NaCl 500 µM α-ketoglutarate, 25 µM iron, 2 mM ascorbic acid, 0.01% Tween-20, 0.5 µM biotinylated peptide substrate, and ab198108 (80 – 400 ng) added to the wells. Add antibody against demethylated K4 peptide. Incubate for 30 min, then Streptavidin-conjugated secondary antibody followed by Alpha Screening detection.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 70 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

    80 µg/ml DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Histone demethylase JARID1A
    • JARID1A
    • Jumonji/ARID domain containing protein 1A
    • Jumonji/ARID domain-containing protein 1A
    • Kdm5a
    • KDM5A_HUMAN
    • Lysine-specific demethylase 5A
    • RBBP-2
    • RBBP2
    • RBP2
    • Retinoblastoma binding protein 2
    • Retinoblastoma-binding protein 2
    see all
  • Function

    Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12.
  • Sequence similarities

    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.
  • Domain

    The GSGFP motif is required for the interaction with SUZ12.
  • Cellular localization

    Nucleus > nucleolus. Occupies promoters of genes involved in RNA metabolism and mitochondrial function.
  • Information by UniProt

Images

  • Specific activity assay of ab198108.

  • 4-20% SDS-PAGE analysis of ab198108.

    Lane 1: 2.1 µg ab198108
    Lane 2: Protein marker

References

ab198108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up