Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPAD WQPPFAVEV DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSS LKIPNVERRILDLYSLSKIVV EEGGYEAICKDRRWARVAQRLNYPPGK NIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP FDNEEKDKEYKPHSI PLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG AGP KMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLE SKEELSH SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLL CDGCDDNYHIFCLLPPLPE IPKGVWRCPKCVMAECKRPPEAFGFEQAT REYTLQSFGEMADSFKADYFNMPVHMVPTEL VEKEFWRLVNSIEEDVT VEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP VLEQS VLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWY GVPSL AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPV VRTNQCAGEFVITFPRA YHSGFNQGYNFAEAVNFCTADWLPAGRQCIE HYRRLRRYCVFSHEELICKMAACPEKLDL NLAAAVHKEMFIMVQEERR LRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA CYDCPDG LVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKV RVA LEVEDGRKRSLEELRALESEARERRFPNSELLQQLKNCLSEAEAC VSRALGLVSGQEAGP HRVAGLQMTLTELRAFLDQMNNLPCAMHQIGDV KGVLEQVEAYQAEAREALASLPSSPGL LQSLLERGRQLGVEVPEAQQL QRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV APSPAVDKA QAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIREAENIPVHLPNI Q ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEE LRQLELQVLTAHS WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKR SRWMEKELGLYKSDTELLGLSAQDL RDPGSVIVAFKEGEQKEKEGILQ LRRTNSAKPSPLASSSTASSTTSICVCGQVLAGAGAL QCDLCQDWFHG RCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLA ELRQRLQAEPR PEEPPNYPAAPASDPLREGSGKDMPKVQGLLENGDSV TSPEKVAPEEGSGKRDLELLSSL LPQLTGPVLELPEATRAPLEELMME GDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLEL EKAERHGSRARGR ALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE E TGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPC PQQPPQQQL
    • Molecular weight

      181 kDa including tags
    • Amino acids

      2 to 1560
    • Tags

      His tag N-Terminus , DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity of 0.078 pmol/min/µg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    >= 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 64% Sodium chloride, 0.02% Potassium chloride, 0.462% DTT, 20% Glycerol

    Also contains 80 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DXS1272E
    • Histone demethylase JARID1C
    • JARID1C
    • JmjC domain containing protein SMCX
    • Jumonji AT rich interactive domain 1C
    • Jumonji, AT rich interactive domain 1C (RBP2 like)
    • Jumonji/ARID domain-containing protein 1C
    • KDM5C
    • KDM5C_HUMAN
    • Lysine (K) specific demethylase 5C
    • Lysine-specific demethylase 5C
    • MRX13
    • MRXJ
    • MRXSCJ
    • MRXSJ
    • Protein SmcX
    • Protein Xe169
    • rbp2 like protein
    • Selected cDNA on X
    • SMCX
    • Smcx homolog X chromosome
    • SmcX protein
    • Smcy homolog X linked
    • XE169
    • Xe169 protein
    see all
  • Function

    Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements.
  • Tissue specificity

    Expressed in all tissues examined. Highest levels found in brain and skeletal muscle.
  • Involvement in disease

    Defects in KDM5C are the cause of mental retardation syndromic X-linked JARID1C-related (MRXSJ) [MIM:300534]. MRXSJ is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRXSJ patients manifest mental retardation associated with variable features such as slowly progressive spastic paraplegia, seizures, facial dysmorphism.
  • Sequence similarities

    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 2 PHD-type zinc fingers.
  • Domain

    The first PHD-type zinc finger domain recognizes and binds H3-K9Me3.
    Both the JmjC domain and the JmjN domain are required for enzymatic activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 10 µL reaction mix containing assay buffer with 20 mM Tris (pH 7.4), 50 mM NaCl 500 µM α-ketoglutarate, 25 µM iron, 2mM ascorbic acid, 0.01% Tween-20, 0.5 µM biotinylated peptide substrate, and ab196392 (50 – 200 ng) added to the wells. Add antibody against demethylated K4 peptide. Incubate for 30 min, then Streptavidin-conjugated secondary antibody followed by detection.

  • 10% SDS PAGE with Coomassie staining: 6 µg ab196392.

References

ab196392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up