Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDK RGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKK ECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT
    • Molecular weight

      19 kDa
    • Amino acids

      32 to 194
    • Additional sequence information

      This product is the mature full length protein from aa 32 to 194. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 as determined by a cell proliferation assay using MTS assay with Human keratinocyte JCRB141 cells was < 10 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 95 % SDS-PAGE.
    ab191586 was purified by chromatographic procedures.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.20
    Constituents: 49% PBS, 50% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FGF 7
    • FGF-7
    • Fgf7
    • FGF7_HUMAN
    • Fibroblast growth factor 7
    • HBGF 7
    • HBGF-7
    • HBGF7
    • Heparin binding growth factor 7
    • Heparin-binding growth factor 7
    • Keratinocyte growth factor
    • KGF
    see all
  • Function

    Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
  • Tissue specificity

    Epithelial cell.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab191586 stained with Coomassie Blue.

References

ab191586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up