Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGG NPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACP LQPDHTNDEKE
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 111

Specifications

Our Abpromise guarantee covers the use of ab132612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HCV NS5A transactivated protein 9
    • HCV NS5A-transactivated protein 9
    • Hepatitis C virus NS5A transactivated protein 9
    • Hepatitis C virus NS5A-transactivated protein 9
    • KIAA0101
    • L5
    • NS5 ATP9
    • NS5ATP9
    • OEATC
    • OEATC 1
    • OEATC-1
    • OEATC1
    • Overexpressed in anaplastic thyroid carcinoma 1
    • p15(PAF)
    • p15PAF
    • PAF
    • PAF_HUMAN
    • PCNA associated factor
    • PCNA-associated factor
    see all
  • Function

    May be involved in protection of cells from UV-induced cell death.
  • Tissue specificity

    Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas and in non-small-cell lung cancer lines.
  • Cellular localization

    Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132612 stained with Coomassie Blue.

References

ab132612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up