Overview

  • Product name
    Recombinant Human KIAA0427 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGE SERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQNGSKDNSLDMLGTDIW AANTFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKL EDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFRRRRNDRRRQQRP PGGNKPQQHGDHQPGSAKHNRDHQKSYQGGSAPHPSGRPTHHGYSQNRRW HHGNMKHPPGDKGEAGAHRNAKETMTIENPKLEDTAGDTGHSSLEAPRSP DTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRL RRRLKEKDEVAVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEA QNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAAKLCDKMALFMVEGTKFRS LLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRSSTGEPFRVLV CPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASA RDKMLCPSESMLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA
    • Amino acids
      1 to 598
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CBP80/20-dependent translation initiation factor
    • ctif
    • CTIF_HUMAN
    • Gm672
    • Hypothetical protein LOC9811
    • Uncharacterized protein KIAA0427
    see all
  • Function
    Specifically required for the pioneer round of mRNA translation mediated by the cap-binding complex (CBC), that takes place during or right after mRNA export via the nuclear pore complex (NPC). Acts via its interaction with the NCBP1/CBP80 component of the CBC complex and recruits the 40S small subunit of the ribosome via eIF3. In contrast, it is not involved in steady state translation, that takes place when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. Also required for nonsense-mediated mRNA decay (NMD), the pioneer round of mRNA translation mediated by the cap-binding complex playing a central role in nonsense-mediated mRNA decay (NMD).
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the CTIF family.
    Contains 1 MIF4G domain.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • ab160663 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up