Description

  • Product name

    Recombinant Human KIAA0513 protein
  • Purity

    > 85 % SDS-PAGE.
    ab202600 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMETPEVPVGSLIDFGPEAPTSSPLEAP PPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNES FSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSS ENGKGREWFARYVSAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGP AKNLMTMCFTYYHIGKPQLLPPESREKPAGSIDSYLKSANSWLAEKKDIA ERLLKNTSARTENVKGFFGGLETKLKGPLARRNEEDENKPQEKRPRAVTA YSPEDEKKGEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTR EKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQ AVIGNLDEEQYKLLSDHIEQMATE
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 401
    • Tags

      His tag N-Terminus
    • Additional sequence information

      KIAA0513

Specifications

Our Abpromise guarantee covers the use of ab202600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • K0513_HUMAN
    • KIAA0513
    • Uncharacterized protein KIAA0513
  • Tissue specificity

    Widely expressed, highest levels in cerebellum, brain cortex, hippocampus, pons, putamen and amygdala. Highly expressed in neurons, but also present in glial cells. Slightly higher expression in the dorsolateral prefrontal cortex of schizophrenic patients compared to control individuals.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of ab202600.

References

ab202600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up