Recombinant human KIAA1549 + BRAF protein (ab204200)

Description

  • Product name

    Recombinant human KIAA1549 + BRAF protein
    See all KIAA1549 + BRAF proteins and peptides
  • Biological activity

    The specific activity of ab204200 was determined to be 550 nmol/min/mg.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSS SSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQ WCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSN NIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDK NPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSK VRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASE PSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
    • Predicted molecular weight

      125 kDa including tags
    • Amino acids

      381 to 766
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_004333.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      YWKLCRTDKLDFQPDTVANIQQRQKLQIPSVKGFDFAKQHLGQHNKDDIL IIHEPAPLPGPLKDHTTPSENGDVPSPKSKIPSKNVRHRGRVSPSDADST VSEESSERDAGDKTPGAVNDGRSHRAPQSGPPLPSSGNEQHSSASIFEHV DRISRPPEASRRVPSKIQLIAMQPIPAPPVQRPSPADRVAESNKINKEIQ TALRHKSEIEHHRNKIRLRAKRRGHYEFPVVDDLSSGDTKERHRVYRRAQ MQIDKILDPTASVPSVFIEPRKSSRIKRSPKPRRKHQVNGCPADAEKDRL ITTDSDGTYRRPPGVHNSAYIGCPSDPDLPADVQTPSSVELGRYPALPFP ASQYIPPQPSIEEARQTMHSLLDDAFALVAPSSQPASTAGVGPGVPPGLP ANSTPSQEERRATQWGSFYSPAQTANNPCS
    • Amino acids

      1320 to 1749
    • Additional sequence information

      NM_001164665.

Specifications

Our Abpromise guarantee covers the use of ab204200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BRAF1
    • p94
    • Proto-oncogene B-Raf
    • RAFB1
    • Serine/threonine-protein kinase B-raf
    • UPF0606 protein KIAA1549
    • v-Raf murine sarcoma viral oncogene homolog B1
    see all
  • Relevance

    BRAF: Protein kinase involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Phosphorylates MAP2K1, and thereby contributes to the MAP kinase signal transduction pathway.
  • Cellular localization

    BRAF: Cell Membrane, Cytoplasmic and Nuclear; KIAA1549: Membrane; Multi-pass membrane protein

Images

  • Kinase assay showing the specific activity of ab204200 as 550 nmol/min/mg.

  • SDS-PAGE analysis of ab204200. Predicted Mw 125KDa.

References

ab204200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up