Overview

  • Product name

    Recombinant Human KIF20A protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSL EDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQA PKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLK GQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPD LKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESR IGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFS IWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQ DAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPK ISELSLCDLAGSERCKDQKSGERLKEAGNINTSLHTLGRCIAALRQNQQN RSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCASTYDETLHVAKF SAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIE NEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQM QQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEE LEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCK AELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQK LGESLQSAERACCHSTGAGKLRQALTTCDDILIKQDQTLAELQNNMVLVK LDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPNQQPPGKKPFL RNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY
    • Amino acids

      1 to 890
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AA415432
    • FLJ21151
    • GG10 2
    • GG10_2
    • KI20A_HUMAN
    • KIF20A
    • kinesin family member 20A
    • Kinesin like protein KIF20A
    • Kinesin-like protein 174
    • Kinesin-like protein KIF20A
    • mitotic kinesin like protein 2
    • Mitotic kinesin-like protein 2
    • MKlp2
    • OTTHUMP00000159481
    • RAB6 interacting, kinesin like (rabkinesin6)
    • Rab6-interacting kinesin-like protein
    • RAB6-INTERACTING PROTEIN, KINESIN-LIKE
    • RAB6KIFL
    • Rabkinesin 6
    • Rabkinesin-6
    see all
  • Function

    Mitotic kinesin required for chromosome passenger complex (CPC)-mediated cytokinesis. Following phosphorylation by PLK1, involved in recruitment of PLK1 to the central spindle. Interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B. May act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. Has a microtubule plus end-directed motility.
  • Sequence similarities

    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
  • Post-translational
    modifications

    Phosphorylated by PLK1 at Ser-528 during mitosis, creating a docking site for PLK1 and recruiting PLK1 at central spindle.
  • Cellular localization

    Golgi apparatus. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt

Images

  • ab153048 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up