Recombinant Human KIF20B protein (ab160559)

Overview

  • Product name
    Recombinant Human KIF20B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKL SNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQII KRRLRTKTAK
    • Amino acids
      1671 to 1780
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 90
    • CT90
    • KI20B_HUMAN
    • KIF20B
    • Kinesin-like protein KIF20B
    • Kinesin-related motor interacting with PIN1
    • KRMP1
    • M-phase phosphoprotein 1
    • MPHOSPH1
    • MPP 1
    • Mpp1
    see all
  • Function
    Plus-end-directed motor enzyme that is required for completion of cytokinesis.
  • Tissue specificity
    Brain, ovary, kidney and testis.
  • Sequence similarities
    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasm > cytoskeleton > spindle. Localizes mainly in the nucleus during interphase although it is also detected in the cytoplasm without clear association with microtubules. A 2-3 fold expression increase is seen as cells progress from G1 to G2/M phase. During prophase and metaphase it is found throughout the cytoplasm and at anaphase accumulates at the midplan of the cell and forms a distinct band extending across the spindle midzone. At anaphase it is concentrated in the mid-body.
  • Information by UniProt

Images

  • ab160559 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up