Description

  • Product name

    Recombinant Human KIF26A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSESGAASPGARTRSLKSPKKRATGLQRRRLIPAPLPDTTALGRKPSLPG QWVDLPPPLAGSLKEPFEIKVYEIDDVERLQRPRPTPREAPTQGLACVST RLRLAERRQQRLREVQAKHKHLCEELAETQGRLMLEPGRWLEQFEVDPEL EPESAEYLAALERATAALEQCVNLCKAHVMMVTCFDISVAASAAIPGPQE VDV
    • Amino acids

      1 to 203
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZP434N178
    • FLJ22753
    • KI26A_HUMAN
    • KIAA1236
    • KIF 26A
    • KIF26A
    • KIF26A variant protein
    • Kinesin family member 26A
    • Kinesin like protein KIF26A
    • Kinesin-like protein KIF26A
    see all
  • Function

    Atypical kinesin that plays a key role in enteric neuron development. Acts by repressing a cell growth signaling pathway in the enteric nervous system development, possibly via its interaction with GRB2 that prevents GRB2-binding to SHC, thereby attenating the GDNF-Ret signaling. Binds to microtubules but lacks microtubule-based motility due to the absence of ATPase activity.
  • Sequence similarities

    Belongs to the kinesin-like protein family. KIF26 subfamily.
    Contains 1 kinesin-motor domain.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161911 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up