Overview

  • Product name
    Recombinant Human KIF3A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHK TDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYG QTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYL GIYNEEVRDLLGKDQTQRLEVIERPDVGVYIKDLSAYVVNNADDMDRIMT LGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVD LAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKAR INEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGE DGEKRKKRRDQTGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKA RAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLL EESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLK KVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIP RDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVD LSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSL LQ
    • Molecular weight
      107 kDa including tags
    • Amino acids
      1 to 702

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIF 3
    • KIF 3A
    • KIF3
    • Kif3a
    • KIF3A_HUMAN
    • Kifl
    • Kinesin family member 3A
    • Kinesin family protein 3
    • Kinesin family protein 3A
    • Kinesin like protein KIF 3A
    • Kinesin like protein KIF3A
    • Kinesin-like protein KIF3A
    • Kns3
    • Microtubule plus end directed kinesin motor 3A
    • Microtubule plus end-directed kinesin motor 3A
    see all
  • Function
    Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro.
  • Sequence similarities
    Belongs to the kinesin-like protein family. Kinesin II subfamily.
    Contains 1 kinesin-motor domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132067, stained with Coomassie Blue.

References

ab132067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up