Description

  • Product name

    Recombinant Human KIF6/Kinesin-13 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEA RSKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRR YKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPA VNSLDHTKPFLQTSDSQHERSQLLSNKSSGGWEVQDQGTGRFDVCDVNAR KILPSPCPSPHSQKQSSTSTPLEDSIPKRPVSSIPLTGDSQTDSDIIAFI KARQSILQKQYLQLLCSLFPKSAVSSAQASTNRKGLSDVLVTR
    • Amino acids

      1 to 293
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as KIF6

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C6orf102
    • dJ1043E3.1
    • dJ137F1.4
    • dJ188D3.1
    • DKFZp451I2418
    • KIF 6
    • Kinesin family member 6
    • Kinesin like protein KIF6
    • MGC33317
    see all
  • Relevance

    KIF6 belongs to the kinesin-like protein family. There are four named isoforms. The KIF6 719Arg variant has been associated with an increased risk of coronary disease and an increased response to statin therapy.
  • Cellular localization

    Cytoplasmic

Images

  • ab165970 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up