Overview

  • Product name

    Recombinant Human KIFC1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEK KRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA TGLKNQKPVPAVPVQKSGTSGVPPMAGGKKPSKRPAWDLKGQLCDLNAEL KRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAE QGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEE KERRLQTSEAALSSSQAEVASLRQETVAQAALLTEREERLHGLEMERRRL HNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSL SRSDERRGTLSGAPAPPPRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALD GYPVCIFAYGQTGSGKTFTMEGGPGGDPQLEGLIPRALRHLFSVAQELSG QGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRAGPGSEELTVT NARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEH SSRGLQCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLG LVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSES LNSLRFASKVNQCVIGTAQANRK
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 673

Specifications

Our Abpromise guarantee covers the use of ab152492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSET
    • HSET KNSL2
    • KIF C1
    • KIFC 1
    • KIFC1
    • KIFC1_HUMAN
    • Kinesin family member C1
    • Kinesin like 2
    • Kinesin like protein 2
    • Kinesin like protein KIFC1
    • Kinesin related protein HSET
    • Kinesin-like protein 2
    • Kinesin-like protein KIFC1
    • Kinesin-related protein HSET
    • KNSL 2
    • KNSL2
    • MGC1202
    • MGC149736
    • MGC149737
    • Mitotic kinesin like protein 2
    • MKLP 2
    • MKLP2
    • RAB6 KIFL
    • Rabkinesin 6
    see all
  • Function

    Minus end-directed microtubule-dependent motor required for bipolar spindle formation. May contribute to movement of early endocytic vesicles.
  • Sequence similarities

    Belongs to the kinesin-like protein family. NCD subfamily.
    Contains 1 kinesin-motor domain.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Early endosome. Associated with nucleus during interphase, centrosomes in early and spindle in later mitosis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152492 stained with Coomassie Blue.

References

ab152492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up