Description

  • Product name

    Recombinant Human KIFC2 protein
    See all KIFC2 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSGSLAPLGTLHLVDLAGSERARKAGAAGPPRGDPDGARRLREAQTINRS LLALGGVMAALRAHRPHVPFRDSQLTRLLQPALGPGTTAVLLLQVGAGAG QVCACRSPPTRARPPAPLARRSPRGRRISGRQSAPSSSPTEWVKWSWGQP GAAGSRAPPGRLLPSAPTLRSPGPPAPLRRPLAVLHAPVPTTARARLSRP QRACPSSPGSRPCPWGLRPGLCWQRR
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      1 to 226

Specifications

Our Abpromise guarantee covers the use of ab131901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.

    Previously labelled as Kinesin C2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIF C2
    • KIFC 2
    • KIFC2
    • KIFC2 protein
    • KIFC2_HUMAN
    • Kinesin C2
    • Kinesin family member C2
    • Kinesin like protein KIFC2
    • Kinesin-like protein KIFC2
    see all
  • Function

    May play a role in microtubule-dependent retrograde axonal transport. May function as the motor for the transport of multivesicular body (MVB)-like organelles in dendrites.
  • Sequence similarities

    Belongs to the kinesin-like protein family.
    Contains 1 kinesin-motor domain.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131901 stained with Coomassie Blue.

References

ab131901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up