Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVE KLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLR LQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKK KKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSP LSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQ GWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFK DTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEG MNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSSLKMQH LNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMS LIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAST GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFI GGYIFLSTRAKDQNESLDEEMFYKLTSGWV
    • Molecular weight

      101 kDa including tags
    • Amino acids

      1 to 680

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ34213
    • FLJ44462
    • UNC112
    • FERM2_HUMAN
    • Fermitin family homolog 2
    • Fermt2
    • KIND2
    • Kindlin-2
    • MIG-2
    • MIG2
    • Mitogen-inducible gene 2 protein
    • PH domain-containing family C member 1
    • Pleckstrin homology domain containing family C (with FERM domain) member 1
    • Pleckstrin homology domain-containing family C member 1
    • PLEKHC1
    • UNC112B
    see all
  • Function

    Participates in the connection between ECM adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites.
  • Tissue specificity

    Ubiquitous. Found in numerous tumor tissues.
  • Sequence similarities

    Belongs to the kindlin family.
    Contains 1 FERM domain.
    Contains 1 PH domain.
  • Domain

    The FERM domain is not correctly detected by PROSITE or Pfam techniques because it contains the insertion of a PH domain.
  • Cellular localization

    Cytoplasm > cell cortex. Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Within actin stress fibers at cell-ECM focal adhesion sites.
  • Information by UniProt

Images

  • ab132759 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up