Description

  • Product name

    Recombinant Human Kinetochore protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQM LKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCE ILKMFLSGLS
    • Amino acids

      2100 to 2209
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HsROD
    • Kinetochore associated 1
    • KNTC1
    • ROD
    • Rough Deal homolog, centromere/kinetochore protein
    see all
  • Relevance

    The kinetochore is the protein structure in eukaryotes which assembles on the centromere and links the chromosome to microtubule polymers from the mitotic spindle during mitosis and meiosis. The kinetochore contains two regions: an inner kinetochore, which is tightly associated with the centromere DNA; and an outer kinetochore, which interacts with microtubules. Even the simplest kinetochores consist of more than 45 different proteins, many of which are conserved throughout eukaryote species.
  • Cellular localization

    Cytoplasmic and Nuclear

Images

  • ab160631 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up