Overview

  • Product name

    Recombinant Human KIR2.3/HIR protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTC VDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPA AGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAV IAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKL CLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGL DRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSA RELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAG LGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
    • Amino acids

      1 to 445
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as KIR2.3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Hippocampal inward rectifier
    • Hippocampal inward rectifier potassium channel
    • HIR
    • HIRK2
    • HRK1
    • Inward rectifier K(+) channel Kir2.3
    • Inward rectifier K+ channel Kir2.3
    • Inward rectifier potassium channel 4
    • Inward rectifier potassium channel Kir 2.3
    • inwardly rectifying subfamily J member 4
    • IRK-3
    • IRK3
    • IRK4_HUMAN
    • KCNJ 4
    • Kcnj4
    • Kir2.3
    • MGC142066
    • MGC142068
    • OTTHUMP00000028922
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 4
    • Potassium inwardly rectifying channel J4
    • Potassium inwardly rectifying channel subfamily J member 4
    see all
  • Function

    This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium.
  • Tissue specificity

    Heart, skeletal muscle, and several different brain regions including the hippocampus.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ4 subfamily.
  • Domain

    The Val/Gly/Ala/Pro stretch may have a functional role in the conductance or permeation properties.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle membrane. TAX1BP3 binding promotes dissociation of KCNJ4 from LIN7 famaly members and KCNJ4 internalization.
  • Information by UniProt

Images

  • ab158785 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up