Description

  • Product name

    Recombinant Human KIR2DL3 protein (His tag)
    See all KIR2DL3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLH LIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIV ITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRF SAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVT GNPSNSWPSPTEPSSETGNPRHLH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      22 to 245
    • Tags

      His tag C-Terminus
    • Additional sequence information

      The amino acid sequence corresponds to the extracellular domain. NP_056952.

Specifications

Our Abpromise guarantee covers the use of ab220454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD158 antigen like family member B2
    • CD158 antigen-like family member B2
    • CD158b
    • CD158b2
    • GL183
    • KI2L3_HUMAN
    • Killer cell immunoglobulin like receptor two domains long cytoplasmic tail 3
    • Killer cell immunoglobulin-like receptor 2DL3
    • Killer inhibitory receptor cl 2-3
    • Killer inhibitory receptor CL2 3
    • KIR 023GB
    • KIR-023GB
    • KIR-K7b
    • KIR-K7c
    • KIR023GB
    • KIR2DL3
    • KIR2DS5
    • KIRCL23
    • MHC class I NK cell receptor
    • Natural killer associated transcript 2
    • Natural killer cell inhibitory receptor KIR2DL3
    • Natural killer-associated transcript 2
    • NKAT
    • NKAT-2
    • NKAT2
    • NKAT2a
    • NKAT2b
    • p58
    • p58 natural killer cell receptor clone CL 6
    • p58 natural killer cell receptor clone CL-6
    • p58 NK Receptor
    • p58 NK receptor CL 6
    • p58 NK receptor CL-6
    • p58.2 MHC class I specific NK receptor
    • p58.2 MHC class-I-specific NK receptor
    see all
  • Function

    Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7). Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220454 stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 45-55 kDa.

References

ab220454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up