Recombinant Human KIR3DL2 protein (Fc Chimera His Tag) (ab223025)

Description

  • Product name

    Recombinant Human KIR3DL2 protein (Fc Chimera His Tag)
  • Purity

    85 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHV PIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVT GNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLV GQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVIT GLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRA VPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGN PSSSWPSPTEPSSKSGICRHLHVEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGKHHHHHH
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      22 to 340
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hlgG-His-tag at C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab223025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD158 antigen like family member K
    • CD158 antigen-like family member K
    • CD158k
    • KI3L2_HUMAN
    • Killer cell immunoglobulin like receptor 3DL2
    • killer cell immunoglobulin like receptor KIR3DL2
    • Killer cell immunoglobulin like receptor, three domains, long cytoplasmic tail, 2
    • Killer cell immunoglobulin-like receptor 3DL2
    • KIR antigen 3DL2
    • KIR3DL2
    • Kirl2
    • MHC class I NK cell receptor
    • Natural killer associated transcript 4
    • natural killer cell inhibitory receptor
    • Natural killer-associated transcript 4
    • NK associated transcript 4
    • NK associated transcript 4A, included
    • NK associated transcript 4B, included
    • NKAT-4
    • NKAT4
    • NKAT4B
    • p140
    • p70 natural killer cell receptor clone CL 5
    • p70 natural killer cell receptor clone CL-5
    • p70 NK receptor CL 5
    • p70 NK receptor CL-5
    see all
  • Function

    Receptor on natural killer (NK) cells for HLA-A alleles. Inhibits the activity of NK cells thus preventing cell lysis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 3 μg of ab223025  analyzed by 15% SDS-PAGE.

    70-100kDa (under reducing conditions).

References

ab223025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up