Overview

  • Product name
    Recombinant Human KIR5.1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTK ARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVES
    • Amino acids
      319 to 416
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6430410F18Rik
    • AI132396
    • BIR9
    • Inward rectifier K channel Kir5.1
    • Inward rectifier K(+) channel Kir5.1
    • Inward rectifier potassium channel 16
    • IRK16
    • IRKG
    • KCNJ16
    • MGC33717
    • Potassium channel inwardly rectifying subfamily J member 16
    • Potassium inwardly rectifying channel subfamily J member 16
    • RP23-218O16.1
    see all
  • Relevance
    KIR5.1 is one of 20 members of the inwardly rectifying potassium (Kir) channel family. Due to its expression in kidney, pancreas and thyroid gland, it has been suggested that human KIR5.1 may be involved in the regulation of fluid and pH balance, thus making it a potential therapeutic target for hypertension, renal failure, or pancreatic disease.
  • Cellular localization
    Membrane; Multi pass membrane protein.

Images

  • ab158788 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up