Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKPFQLDLLFVCFFLFSQELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSF SQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYL VVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDP VILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLL RDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPP LVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYR TTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGS DAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRA VVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDR IAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCT AWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLV LMATIVAFCCARSQRNLKGVVSAKNDIRVEIVHKEPASGREGEEHSTIKQ LMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYYSVNTFKEHHSTP TISLSSCQPDLRPAGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMG SSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKAS ASSSHHSQSSSQNSDPSRPLQRRMQTHV
    • Amino acids

      1 to 778
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA1867
    • Kin of IRRE like 3
    • Kin of IRRE like 3 (Drosophila)
    • kin of IRRE-like protein 3
    • Kin of irregular chiasm like protein 3
    • KIRRE
    • KIRRE, mouse, homolog of
    • KIRREL3
    • MRD4
    • NEPH2
    • Nephrin like 2
    • Nephrin like protein 2
    • PRO19814
    • PRO4502
    • UNQ5923
    see all
  • Relevance

    NEPH2 is a member of the nephrin like protein family, which includes NEPH1 (KIRREL; MIM 607428) and NEPH3 (KIRREL2; MIM 607762). The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2; MIM 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size and charge selective ultrafiltration (Sellin et al., 2003 [PubMed 12424224]).
  • Cellular localization

    Cell membrane; Single-pass type I membrane protein

Images

  • ab153551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up