Description

  • Product name

    Recombinant Human KLF3 protein
    See all KLF3 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTP EGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSS SPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPGILPVIQPVVV QPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIE PGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVES PDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWK FARSGELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
    • Amino acids

      1 to 345
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Basic krueppel-like factor
    • Basic Kruppel like factor
    • BKLF3
    • CACCC box binding protein BKLF
    • CACCC-box-binding protein BKLF
    • Klf3
    • KLF3_HUMAN
    • Krueppel-like factor 3
    • Kruppel like factor 3 (basic)
    • MGC48279
    • TEF-2
    • TEF2
    • Transcript ch138
    • Zinc finger protein 741
    • ZNF741
    see all
  • Function

    Binds to the CACCC box of erythroid cell-expressed genes. May play a role in hematopoiesis.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Sumoylated by SUMO1. Sumoylation is enhanced by PIAS1, PIAS2alpha and PIAS2beta, and PIAS4, but not by Pc2. Enhances transcriptional repression, but has no effect on DNA binding. Sumoylation on Lys-198 is the major site.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162484 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up