Overview

  • Product name

    Recombinant Human KLF6 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYV SASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE TNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPS SPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH RCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRH FRKHTGAKPF
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 261

Specifications

Our Abpromise guarantee covers the use of ab114550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B cell derived protein 1
    • B cell-derived 1
    • B-cell-derived protein 1
    • BCD1
    • CBA1
    • COPEB
    • Core promoter element-binding protein
    • CPBP
    • GBF
    • GC rich binding factor
    • GC rich sites binding factor GBF
    • GC-rich sites-binding factor GBF
    • Klf6
    • KLF6_HUMAN
    • Krueppel-like factor 6
    • Krueppel-like factor 6 isoform C
    • Kruppel like zinc finger protein Zf9
    • PAC1
    • Proto-oncogene BCD1
    • Protooncogene B cell derived 1
    • ST12
    • Suppression of tumorigenicity 12 (prostate)
    • Suppressor of tumorigenicity 12 protein
    • Transcription factor Zf9
    • Zf9
    see all
  • Function

    Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.
  • Tissue specificity

    Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
  • Involvement in disease

    Defects in KLF6 are a cause of gastric cancer (GASC) [MIM:613659]; also called gastric cancer intestinal or stomach cancer. Gastric cancer is a malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
    Defects in KLF6 are a cause of prostate cancer (PC) [MIM:176807]. Prostate cancer is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Domain

    The acidic N-terminal part may favor interaction with the basic domain of transcription factors.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114550

References

ab114550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up