Overview

  • Product name

    Recombinant Human KLF9 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYR PIQTPSVCSDSLESPDEDMGSDSDVTT
    • Molecular weight

      34 kDa including tags
    • Amino acids

      25 to 101

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Basic transcription element binding protein 1
    • Basic transcription element-binding protein 1
    • BTE binding protein 1
    • BTE-binding protein 1
    • BTEB
    • BTEB 1
    • BTEB1
    • GC box binding protein 1
    • GC-box-binding protein 1
    • KLF 9
    • KLF9
    • KLF9_HUMAN
    • Krueppel like factor 9
    • Krueppel-like factor 9
    • Transcription factor BTEB 1
    • Transcription factor BTEB1
    see all
  • Function

    Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box.
  • Sequence similarities

    Belongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up